RFPL3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TRIM31 antibody: synthetic peptide directed towards the middle region of human TRIM31. Synthetic peptide located within the following region: HSLFRASSAGKVTFPVCLLASYDEISGQGASSQDTKTFDVALSEELHAAL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	48 kDa
Gene Name	ret finger protein like 3
Database Link	NP_001092005 Entrez Gene 10738 Human UniProt ID O75679
Background	TRIM31 encodes for a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to both the cytoplasm and the nucleus.
Synonyms	OTTHUMP00000165867
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.