HOXB3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-HOXB3 antibody: synthetic peptide directed towards the middle region of human HOXB3. Synthetic peptide located within the following region: SGNLDYNGAPPMAPSQHHGPCEPHPTYTDLSSHHAPPPQGRIQEAPKLTH
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	44 kDa
Gene Name	homeobox B3
Database Link	NP_002137 Entrez Gene 3213 Human UniProt ID P14651
Background	HOXB3 belongs to ANTP homeobox family. It is a nuclear protein with a homeobox DNA-binding domain. HOXB3 gene is included in a cluster of homeobox B genes located on chromosome 17. The protein functions as a sequence-specific transcription factor that is involved in development. Increased expression of this gene is associated with a distinct biologic subset of acute myeloid leukemia (AML).
Synonyms	Hox-2.7; HOX2; HOX2G
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Mouse: 93%; Rabbit: 78%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.