ZNF334 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF334 antibody: synthetic peptide directed towards the N terminal of human ZNF334. Synthetic peptide located within the following region: KMKKFQIPVSFQDLTVNFTQEEWQQLDPAQRLLYRDVMLENYSNLVSVGY
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	80 kDa
Gene Name	zinc finger protein 334
Database Link	NP_060572 Entrez Gene 55713 Human UniProt ID Q9HCZ1
Background	ZNF334 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 14 C2H2-type zinc fingers and 1 KRAB domain. ZNF334 may be involved in transcriptional regulation.
Synonyms	OTTHUMP00000031209; zinc finger protein 334
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 86%; Dog: 79%; Pig: 79%; Rat: 79%; Horse: 79%; Mouse: 79%; Bovine: 79%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.