C2orf3 (GCFC2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C2orf3 antibody: synthetic peptide directed towards the N terminal of human C2orf3. Synthetic peptide located within the following region: SEPDDHEKRIPFTLRPQTLRQRMAEESISRNEETSEESQEDEKQDTWEQQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	89 kDa
Gene Name	GC-rich sequence DNA-binding factor 2
Database Link	NP_003194 Entrez Gene 6936 Human UniProt ID P16383
Background	The first mRNA transcript isolated for C2orf3 gene was part of an artificial chimera derived from two distinct gene transcripts and a primer used in the cloning process (see Genbank accession M29204). C2orf3 belongs to the GCF family. It is a factor that represses transcription. It binds to the GC-rich sequences (5'-GCGGGGC-3') present in the epidermal growth factor receptor, beta-actin, and calcium-dependent protease promoters.The first mRNA transcript isolated for this gene was part of an artificial chimera derived from two distinct gene transcripts and a primer used in the cloning process (see Genbank accession M29204). A positively charged amino terminus present only in the chimera was determined to bind GC-rich DNA, thus mistakenly thought to identify a transcription factor gene.
Synonyms	C2orf3; DNABF; GCF; TCF9
Note	Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 92%; Rat: 92%; Guinea pig: 92%; Horse: 85%; Mouse: 85%; Rabbit: 83%; Bovine: 79%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.