TFEB Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TFEB antibody: synthetic peptide directed towards the middle region of human TFEB. Synthetic peptide located within the following region: DFSHSLSFGGREDEGPPGYPEPLAPGHGSPFPSLSKKDLDLMLLDDSLLP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	53 kDa
Gene Name	transcription factor EB
Database Link	NP_009093 Entrez Gene 7942 Human UniProt ID P19484
Background	The TFEB gene fuses with an intronless gene in renal tumors harboring the t(6;11)(p21;q13) chromosome translocation. It encodes a protein that is a highly sensitive and specific diagnostic marker for renal neoplasms.
Synonyms	ALPHATFEB; BHLHE35; TCFEB
Note	Immunogen Sequence Homology: Human: 100%; Dog: 86%; Rabbit: 86%; Horse: 85%; Goat: 79%; Bovine: 79%
Reference Data
Protein Families	Druggable Genome, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.