JHDM1D (KDM7A) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-JHDM1D antibody: synthetic peptide directed towards the middle region of human JHDM1D. Synthetic peptide located within the following region: LDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	106 kDa
Gene Name	lysine demethylase 7A
Database Link	NP_085150 Entrez Gene 80853 Human UniProt ID Q6ZMT4
Background	JHDM1D belongs to the JHDM1 histone demethylase family. It contains 1 JmjC domain and 1 PHD-type zinc finger. The function of JHDM1D remains unknown.
Synonyms	JHDM1D
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 92%; Dog: 85%; Rat: 85%; Mouse: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.