IMPA2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-IMPA2 antibody: synthetic peptide directed towards the middle region of human IMPA2. Synthetic peptide located within the following region: RGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLH
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	32 kDa
Gene Name	inositol monophosphatase 2
Database Link	NP_055029 Entrez Gene 3613 Human UniProt ID O14732
Background	IMPA2 belongs to the inositol monophosphatase family. The present study suggests that a promoter haplotype of IMPA2 possibly contributes to risk for bipolar disorder by elevating IMPA2 levels in the brain, albeit the genetic effect varies among populations.
Synonyms	inosine monophosphatase 2; inositol(myo)-1(or 4)-monophosphatase 2; inositol monophosphatase 2 variant 1; inositol monophosphatase 2 variant 2
Note	Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Dog: 93%; Pig: 86%; Horse: 86%; Guinea pig: 86%; Rat: 85%; Mouse: 85%; Rabbit: 85%
Reference Data
Protein Pathways	Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.