SPFH2 (ERLIN2) Rabbit Polyclonal Antibody
CAT#: TA344331
Rabbit Polyclonal Anti-ERLIN2 Antibody - middle region
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ERLIN2 antibody: synthetic peptide directed towards the middle region of human ERLIN2. Synthetic peptide located within the following region: ASNSKIYFGKDIPNMFMDSAGSVSKQFEGLADKLSFGLEDEPLETATKEN |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 38 kDa |
Gene Name | ER lipid raft associated 2 |
Database Link | |
Background | ERLIN2 plays an important role in the early steps of the endoplasmic reticulum-associated degradation (ERAD) pathway. It is involved in ITPR1 degradation by the ERAD pathway. |
Synonyms | C8orf2; Erlin-2; NET32; SPFH2; SPG18 |
Note | Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Rat: 93%; Mouse: 86%; Pig: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |