Plexin A4 (PLXNA4) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PLXNA4 antibody: synthetic peptide directed towards the middle region of human PLXNA4. Synthetic peptide located within the following region: TQEWIGVEGDPPGANIASQEQMLCVYLQCSSHKAISDQRVQPLLCCFLNV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	57 kDa
Gene Name	plexin A4
Database Link	NP_861440 Entrez Gene 91584 Human UniProt ID Q9HCM2
Background	This protein mediates semaphorin receptor activity.
Synonyms	FAYV2820; PLEXA4; PLXNA4A; PLXNA4B; PRO34003
Note	Immunogen Sequence Homology: Human: 100%; Yeast: 90%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.