Neugrin (NGRN) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NGRN antibody: synthetic peptide directed towards the N terminal of human NGRN. Synthetic peptide located within the following region: MAVTLSLLLGGRVCAAVTRCGFATRGVAGPGPIGREPDPDSDWEPEEREL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	32 kDa
Gene Name	neugrin, neurite outgrowth associated
Database Link	NP_001028260 Entrez Gene 51335 Human UniProt ID Q9NPE2
Background	NGRN may be involved in neuronal differentiation.
Synonyms	DSC92
Note	Immunogen Sequence Homology: Human: 100%; Rat: 93%; Dog: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.