GNL3L Rabbit Polyclonal Antibody
CAT#: TA344198
Rabbit Polyclonal Anti-GNL3L Antibody - N-terminal region
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | IF, WB |
Recommend Dilution | WB, IF |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-GNL3L antibody: synthetic peptide directed towards the N terminal of human GNL3L. Synthetic peptide located within the following region: QQAAREQERQKRRTIESYCQDVLRRQEEFEHKEEVLQELNMFPQLDDEAT |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 65 kDa |
Gene Name | G protein nucleolar 3 like |
Database Link | |
Background | GNL3L is required for normal processing of ribosomal pre-rRNA and cell proliferation. |
Synonyms | GNL3B |
Note | Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Pig: 93%; Horse: 93%; Dog: 86%; Rat: 86%; Rabbit: 86%; Guinea pig: 86%; Mouse: 79% |
Reference Data | |
Protein Families | Protease |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |