LZTS2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-LZTS2 antibody: synthetic peptide directed towards the N terminal of human LZTS2. Synthetic peptide located within the following region: EPLCPAVPPRKAVPVTSFTYINEDFRTESPPSPSSDVEDAREQRAHNAHL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	73 kDa
Gene Name	leucine zipper, putative tumor suppressor 2
Database Link	NP_115805 Entrez Gene 84445 Human UniProt ID Q9BRK4
Background	LZTS2 is a negative regulator of katanin-mediated microtubule severing and release from the centrosome. LZTS2 is required for central spindle formation and the completion of cytokinesis. LZTS2 may negatively regulate axonal outgrowth by preventing the for
Synonyms	LAPSER1
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.