WDR9 (BRWD1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-BRWD1 antibody: synthetic peptide directed towards the N terminal of human BRWD1. Synthetic peptide located within the following region: MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	13 kDa
Gene Name	bromodomain and WD repeat domain containing 1
Database Link	NP_001007247 Entrez Gene 54014 Human UniProt ID Q9NSI6
Background	This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein com
Synonyms	C21orf107; DCAF19; N143; WDR9
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 92%; Dog: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.