GIPC (GIPC2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-GIPC2 antibody is: synthetic peptide directed towards the C-terminal region of Human GIPC2. Synthetic peptide located within the following region: KAKAIEKIDDVLELYMGIRDIDLATTMFEAGKDKVNPDEFAVALDETLGD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	34 kDa
Gene Name	GIPC PDZ domain containing family member 2
Database Link	NP_060125 Entrez Gene 54810 Human UniProt ID Q8TF65
Background	GIPC1/GIPC, GIPC2, and GIPC3 are a family of central PDZ-domain proteins. GIPC2 might play important roles in human gastric cancer through modulation of growth factor signaling or cell adhesion. GIPC1, GIPC2 and GIPC3 might play key roles in carcinogenesis and embryogenesis through modulation of growth factor signaling and cell adhesion.
Synonyms	SEMCAP-2; SEMCAP2
Note	Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%; Rabbit: 86%; Zebrafish: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.