Frizzled 9 (FZD9) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FZD9 antibody: synthetic peptide directed towards the N terminal of human FZD9. Synthetic peptide located within the following region: RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	65 kDa
Gene Name	frizzled class receptor 9
Database Link	NP_003499 Entrez Gene 8326 Human UniProt ID O00144
Background	FZD9 contains 1 FZ (frizzled) domain and belongs to the G-protein coupled receptor Fz/Smo family. It is receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members. It may be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD9 gene is located within the Williams syndrome common deletion region of chromosome 7, and heterozygous deletion of the FZD9 gene may contribute to the Williams syndrome phenotype. FZD9 is expressed predominantly in brain, testis, eye, skeletal muscle, and kidney.
Synonyms	CD349; FZD3
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%; Rat: 93%; Mouse: 93%; Rabbit: 92%
Reference Data
Protein Families	Druggable Genome, GPCR, Transmembrane
Protein Pathways	Basal cell carcinoma, Colorectal cancer, Melanogenesis, Pathways in cancer, Wnt signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.