Synaptojanin (SYNJ1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SYNJ1 antibody: synthetic peptide directed towards the middle region of human SYNJ1. Synthetic peptide located within the following region: PGVARREMEAPKSPGTTRKDNIGRSQPSPQAGLAGPGPAGYSTARPTIPP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	173 kDa
Gene Name	synaptojanin 1
Database Link	NP_003886 Entrez Gene 8867 Human UniProt ID O43426
Background	Synaptojanin 1 is a phosphoinositide phosphatase that regulates levels of membrane phosphatidylinositol-4,5-bisphosphate. As such, expression of this enzyme may affect synaptic transmission and membrane trafficking.
Synonyms	INPP5G; PARK20
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Horse: 93%; Rabbit: 93%; Rat: 92%; Mouse: 92%; Dog: 86%; Guinea pig: 86%
Reference Data
Protein Families	Druggable Genome, Phosphatase
Protein Pathways	Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.