TMED4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TMED4 antibody: synthetic peptide directed towards the N terminal of human TMED4. Synthetic peptide located within the following region: LRAMGRQALLLLALCATGAQGLYFHIGETEKRCFIEEIPDETMVIGNYRT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	25 kDa
Gene Name	transmembrane p24 trafficking protein 4
Database Link	NP_872353 Entrez Gene 222068 Human UniProt ID Q7Z7H5
Background	TMED4 contains 1 GOLD domain and belongs to the EMP24/GP25L family. The function remains unknown.
Synonyms	ERS25; GMP25iso; HNLF; p24a3; p24alpha3
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 92%; Mouse: 91%; Zebrafish: 90%; Pig: 86%; Rat: 86%; Bovine: 79%; Guinea pig: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.