Mrpl21 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Mrpl21 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LPDPVEETRHHAEVVKRVNELIATGQYGRLFAVVHFASHQWKVTAEDLIL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	24 kDa
Gene Name	mitochondrial ribosomal protein L21
Database Link	NP_758456 Entrez Gene 353242 Mouse UniProt ID Q9D1N9
Background	The function of this protein remains unknown.
Synonyms	L21mt; MGC62013; MRP-L21
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Mouse: 93%; Guinea pig: 93%; Bovine: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.