DIS3L2 Rabbit Polyclonal Antibody
CAT#: TA344005
Rabbit Polyclonal Anti-MGC42174 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 4,840.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-MGC42174 antibody: synthetic peptide directed towards the N terminal of human MGC42174. Synthetic peptide located within the following region: WKVVKPESNDKETEAAYESDIPEELCGHHLPQQSLKSYNDSPDVIVEAQF |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 68 kDa |
Gene Name | DIS3 like 3'-5' exoribonuclease 2 |
Database Link | |
Background | The function remains unknown. |
Synonyms | FAM6A; hDIS3L2; PRLMNS |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 93%; Bovine: 93%; Dog: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Guinea pig: 86%; Rabbit: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |