RG9MTD3 (TRMT10B) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RG9MTD3 antibody: synthetic peptide directed towards the C terminal of human RG9MTD3. Synthetic peptide located within the following region: HALEDVDLNKVYILGGLVDESIQKKVTFQKAREYSVKTARLPIQEYMVRN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	36 kDa
Gene Name	tRNA methyltransferase 10B
Database Link	NP_659401 Entrez Gene 158234 Human UniProt ID Q6PF06
Background	RG9MTD3 belongs to the RNA methyltransferase trmD family, TRM10 subfamily. It is a probable RNA methyltransferase.
Synonyms	bA3J10.9; RG9MTD3
Note	Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Rat: 93%; Horse: 93%; Dog: 86%; Pig: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.