ALKBH8 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ALKBH8 antibody: synthetic peptide directed towards the N terminal of human ALKBH8. Synthetic peptide located within the following region: MDSNHQSNYKLSKTEKKFLRKQIKAKHTLLRHEGIETVSYATQSLVVANG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	27 kDa
Gene Name	alkB homolog 8, tRNA methyltransferase
Database Link	NP_620130 Entrez Gene 91801 Human UniProt ID Q96BT7
Background	The function remains unknown.
Synonyms	ABH8; TRM9; TRMT9
Note	Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Dog: 93%; Pig: 86%; Horse: 86%; Rat: 79%; Guinea pig: 79%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.