RAVER1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RAVER1 antibody: synthetic peptide directed towards the N terminal of human RAVER1. Synthetic peptide located within the following region: VTHRPPLSPKSGAEVEAGDAAERRAPEEELPPLDPEEIRKRLEHTERQFR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	67 kDa
Gene Name	ribonucleoprotein, PTB binding 1
Database Link	NP_597709 Entrez Gene 125950 Human UniProt ID Q8IY67
Background	RAVER1 contains 3 RRM (RNA recognition motif) domains. It cooperates with PTBP1 to modulate regulated alternative splicing events and promotes exon skipping. It cooperates with PTBP1 to modulate switching between mutually exclusive exons during maturation of the TPM1 pre-mRNA.
Synonyms	KIAA1978
Note	Immunogen Sequence Homology: Human: 100%; Horse: 86%; Bovine: 86%; Rabbit: 86%; Dog: 79%; Pig: 79%; Guinea pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.