RAVER1 Rabbit Polyclonal Antibody

CAT#: TA343977

Rabbit Polyclonal Anti-RAVER1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of ribonucleoprotein, PTB-binding 1 (RAVER1)
    • 100 ug

CNY 4,840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Purified recombinant protein of Homo sapiens ribonucleoprotein, PTB-binding 1 (RAVER1), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Purified recombinant protein of Homo sapiens ribonucleoprotein, PTB-binding 1 (RAVER1), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-RAVER1 antibody: synthetic peptide directed towards the N terminal of human RAVER1. Synthetic peptide located within the following region: VTHRPPLSPKSGAEVEAGDAAERRAPEEELPPLDPEEIRKRLEHTERQFR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Protein A purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 67 kDa
Gene Name ribonucleoprotein, PTB binding 1
Background RAVER1 contains 3 RRM (RNA recognition motif) domains. It cooperates with PTBP1 to modulate regulated alternative splicing events and promotes exon skipping. It cooperates with PTBP1 to modulate switching between mutually exclusive exons during maturation of the TPM1 pre-mRNA.
Synonyms KIAA1978
Note Immunogen Sequence Homology: Human: 100%; Horse: 86%; Bovine: 86%; Rabbit: 86%; Dog: 79%; Pig: 79%; Guinea pig: 79%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...