LARP4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-LARP4 antibody: synthetic peptide directed towards the middle region of human LARP4. Synthetic peptide located within the following region: VSPTKNEDNGAPENSVEKPHEKPEARASKDYSGFRGNIIPRGAAGKIREQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	72 kDa
Gene Name	La ribonucleoprotein domain family member 4
Database Link	NP_954660 Entrez Gene 113251 Human UniProt ID Q71RC2
Background	The specific functin of this protein remains unknown.
Synonyms	PP13296
Note	Immunogen Sequence Homology: Horse: 100%; Human: 100%; Pig: 93%; Rat: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Mouse: 92%; Dog: 86%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.