Apolipoprotein O (APOO) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FAM121B antibody: synthetic peptide directed towards the C terminal of human FAM121B. Synthetic peptide located within the following region: LYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKPGNVKNSPGTK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	22 kDa
Gene Name	apolipoprotein O
Database Link	NP_077027 Entrez Gene 79135 Human UniProt ID Q9BUR5
Background	FAM121B belongs to the FAM121 family and the function remains unknown.
Synonyms	FAM121B; Mic23; MIC26; My025
Note	Immunogen Sequence Homology: Dog: 100%; Human: 100%; Horse: 93%; Mouse: 93%; Pig: 86%; Rat: 86%; Bovine: 86%
Reference Data
Protein Families	Secreted Protein, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.