RG9MTD1 (TRMT10C) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RG9MTD1 antibody: synthetic peptide directed towards the middle region of human RG9MTD1. Synthetic peptide located within the following region: MKRKELQNTVSQLLESEGWNRRNVDPFHIYFCNLKIDGALHRELVKRYQE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	47
Gene Name	tRNA methyltransferase 10C, mitochondrial RNase P subunit
Database Link	NP_060289 Entrez Gene 54931 Human UniProt ID Q7L0Y3
Background	RG9MTD1 functions in mitochondrial tRNA maturation. Part of mitochondrial ribonuclease P, an enzyme composed of MRPP1/RG9MTD1, MRPP2/HSD17B10 and MRPP3/KIAA0391, which cleaves tRNA molecules in their 5'-ends.
Synonyms	COXPD30; HNYA; MRPP1; RG9MTD1
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Horse: 93%; Pig: 92%; Guinea pig: 92%; Bovine: 86%; Rabbit: 86%; Zebrafish: 85%; Dog: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.