FOXRED1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FOXRED1 antibody: synthetic peptide directed towards the N terminal of human FOXRED1. Synthetic peptide located within the following region: SEIKKKIKSILPGRSCDLLQDTSHLPPEHSDVVIVGGGVLGLSVAYWLKK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	54 kDa
Gene Name	FAD-dependent oxidoreductase domain containing 1
Database Link	NP_060017 Entrez Gene 55572 Human UniProt ID Q96CU9
Background	The function of this protein remains unknown.
Synonyms	FP634; H17
Note	Immunogen Sequence Homology: Horse: 100%; Human: 100%; Dog: 92%; Pig: 92%; Rat: 92%; Bovine: 92%; Rabbit: 92%; Guinea pig: 92%; Mouse: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.