TRNT1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TRNT1 antibody: synthetic peptide directed towards the N terminal of human TRNT1. Synthetic peptide located within the following region: PQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENFEITT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	45 kDa
Gene Name	tRNA nucleotidyl transferase 1
Database Link	NP_057084 Entrez Gene 51095 Human UniProt ID Q96Q11
Background	TRNT1 belongs to the tRNA nucleotidyltransferase/poly(A) polymerase family. It adds and repairs the conserved 3'-CCA sequence necessary for the attachment of amino acids to the 3' terminus of tRNA molecules, using CTP and ATP as substrates.
Synonyms	1; CCA-adding; CCA1; CGI-47; mitochondrial CCA-adding tRNA-nucleotidyltransferase; MtCCA; tRNA nucleotidyl transferase
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Zebrafish: 93%; Guinea pig: 93%; Rabbit: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.