RRP7A Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CTA-126B4.3 antibody: synthetic peptide directed towards the N terminal of human CTA-126B4.3. Synthetic peptide located within the following region: NVPPYCTEESLSRLLSTCGLVQSVELQEKPDLAESPKESRSKFFHPKPVP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	32 kDa
Gene Name	ribosomal RNA processing 7 homolog A
Database Link	NP_056518 Entrez Gene 27341 Human UniProt ID Q9Y3A4
Background	The exact function of CTA-126B4.3 remains unknown.
Synonyms	BK126B4.3; CGI-96
Note	Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Pig: 92%; Mouse: 92%; Bovine: 92%; Dog: 83%; Rabbit: 83%; Guinea pig: 75%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.