ZNF510 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF510 antibody: synthetic peptide directed towards the middle region of human ZNF510. Synthetic peptide located within the following region: RKAILSDHQRIHTGEKPFQCNKCGKTFGQKSNLRIHQRTHSGEKSYECNE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	79 kDa
Gene Name	zinc finger protein 510
Database Link	NP_055745 Entrez Gene 22869 Human UniProt ID Q9Y2H8
Background	ZNF510 may be involved in transcriptional regulation.
Synonyms	KIAA0972; MGC33740
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Dog: 92%; Mouse: 92%; Bovine: 92%; Rat: 85%; Guinea pig: 79%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.