Hoxd9 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Hoxd9 antibody is: synthetic peptide directed towards the N-terminal region of Rat Hoxd9. Synthetic peptide located within the following region: MSSSGTLSNYYVDSLIGHEGDEVFAARFGPPGPGTQGRPAGVADGPAAAA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	homeo box D9
Database Link	NP_001166940 Entrez Gene 688999 Rat UniProt ID B5DFK3
Background	Hoxd9 is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Synonyms	Hox-4.3; Hox-4C; Hox-5.2; HOX4; HOX4C
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Rabbit: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.