GTF3C5 Rabbit Polyclonal Antibody

CAT#: TA343678

Rabbit Polyclonal Anti-GTF3C5 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human general transcription factor IIIC, polypeptide 5, 63kDa (GTF3C5), transcript variant 2, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Transient overexpression lysate of general transcription factor IIIC, polypeptide 5, 63kDa (GTF3C5), transcript variant 1
    • 100 ug

CNY 3,080.00


Recombinant protein of human general transcription factor IIIC, polypeptide 5, 63kDa (GTF3C5), transcript variant 2, 100 µg
    • 100 ug

CNY 9,998.00


Transient overexpression lysate of general transcription factor IIIC, polypeptide 5, 63kDa (GTF3C5), transcript variant 2
    • 100 ug

CNY 3,080.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-GTF3C5 antibody: synthetic peptide directed towards the C terminal of human GTF3C5. Synthetic peptide located within the following region: SKRPALFSSSAKADGGKEQLTYESGEDEEDEEEEEEEEEDFKPSDGSENE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 60 kDa
Gene Name general transcription factor IIIC subunit 5
Background GTF3C5 is polypeptide 5 of general transcription factor IIIon Channel. Human transcription factor IIIon Channel (hTFIIIon Channel) is a multisubunit complex that directly recognizes promoter elements and recruits TFIIIB and RNA polymerase III.
Synonyms TFiiiC2-63; TFIIIC63; TFIIICepsilon
Note Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Bovine: 93%; Rabbit: 93%; Pig: 77%; Guinea pig: 77%
Reference Data
Protein Families Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...