GTF3C5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GTF3C5 antibody: synthetic peptide directed towards the C terminal of human GTF3C5. Synthetic peptide located within the following region: SKRPALFSSSAKADGGKEQLTYESGEDEEDEEEEEEEEEDFKPSDGSENE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	60 kDa
Gene Name	general transcription factor IIIC subunit 5
Database Link	NP_036219 Entrez Gene 9328 Human UniProt ID Q9Y5Q8
Background	GTF3C5 is polypeptide 5 of general transcription factor IIIon Channel. Human transcription factor IIIon Channel (hTFIIIon Channel) is a multisubunit complex that directly recognizes promoter elements and recruits TFIIIB and RNA polymerase III.
Synonyms	TFiiiC2-63; TFIIIC63; TFIIICepsilon
Note	Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Bovine: 93%; Rabbit: 93%; Pig: 77%; Guinea pig: 77%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.