ZNF175 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF175 antibody: synthetic peptide directed towards the C terminal of human ZNF175. Synthetic peptide located within the following region: QRIHTGERPYVCSECGKAFNNRSNFNKHQTTHTRDKSYKCSYSVKGFTKQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	81 kDa
Gene Name	zinc finger protein 175
Database Link	NP_009078 Entrez Gene 7728 Human UniProt ID Q9Y473
Background	ZNF175 expression in brain mononuclear phagocytes is a signature for advanced HIV-1 encephalitis. As a transcriptional suppressor, this protein plays a role in macrophage control of viral replication during advanced HIV-1 infection.
Synonyms	OTK18
Note	Immunogen Sequence Homology: Horse: 100%; Human: 100%; Bovine: 100%; Rat: 86%; Dog: 85%; Pig: 85%; Mouse: 79%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.