ZBTB25 Rabbit Polyclonal Antibody
CAT#: TA343650
Rabbit Polyclonal Anti-ZBTB25 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ZBTB25 antibody: synthetic peptide directed towards the middle region of human ZBTB25. Synthetic peptide located within the following region: GNALAQRFQPYCDSWSDVSLKSSRLSQEHLDLPCALESELTQENVDTILV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 49 kDa |
Gene Name | zinc finger and BTB domain containing 25 |
Database Link | |
Background | ZBTB25 contains 1 BTB (POZ) domain and 2 C2H2-type zinc fingers and belongs to the krueppel C2H2-type zinc-finger protein family. ZBTB25 may be involved in transcriptional regulation. |
Synonyms | C14orf51; KUP; ZNF46 |
Note | Immunogen Sequence Homology: Human: 100%; Rat: 92%; Horse: 92%; Mouse: 92%; Dog: 79%; Bovine: 79% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |