LZTR1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-LZTR1 antibody: synthetic peptide directed towards the C terminal of human LZTR1. Synthetic peptide located within the following region: GFYNNRLQAYCKQNLEMNVTVQNVLQILEAADKTQALDMKRHCLHIIVHQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	95 kDa
Gene Name	leucine-zipper-like transcription regulator 1
Database Link	NP_006758 Entrez Gene 8216 Human UniProt ID Q8N653
Background	Leucine-zipper-like transcriptional regulator 1(LZTR1) is belived to be a DNA-binding protein and transcriptional regulator based on its predicted structural characteristics. The transcript is present in several essential fetal organs and is hemizygously deleted in some DiGeorge syndrome patients. LZTR1 is thought to play a critical role in embryogenesis.Leucine-zipper-like transcriptional regulator 1 is belived to be a DNA-binding protein and transcriptional regulator based on its predicted structural characteristics. The transcript is present in several essential fetal organs and is hemizygously deleted in some DiGeorge syndrome patients. It is thought to play a critical role in embryogenesis.
Synonyms	BTBD29; LZTR-1; NS10; SWNTS2
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.