ZNF192 (ZKSCAN8) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF192 antibody: synthetic peptide directed towards the middle region of human ZNF192. Synthetic peptide located within the following region: NGNTGLIQHLRIHTGEKPYQCNECGKAFIQRSSLIRHQRIHSGEKSESIS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	66 kDa
Gene Name	zinc finger with KRAB and SCAN domains 8
Database Link	NP_006289 Entrez Gene 7745 Human UniProt ID Q15776
Background	ZNF192 belongs to the krueppel C2H2-type zinc-finger protein family and contains the conserved SCAN box domain. ZNF192 may be involved in transcriptional regulation.
Synonyms	LD5-1; ZNF192; ZSCAN40
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.