LXR alpha (NR1H3) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NR1H3 antibody: synthetic peptide directed towards the N terminal of human NR1H3. Synthetic peptide located within the following region: MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	50 kDa
Gene Name	nuclear receptor subfamily 1 group H member 3
Database Link	NP_005684 Entrez Gene 10062 Human UniProt ID Q13133
Background	Interaction of NR1H3 with RXR shifts RXR from its role as a silent DNA-binding partner to an active ligand-binding subunit in mediating retinoid responses through target genes defined by LXRES. NR1H3 are DR4-type response elements characterized by direct repeats of two similar hexanuclotide half-sites spaced by four nucleotides. NR1H3 Plays an important role in the regulation of cholesterol homeostasis.
Synonyms	LXR-a; LXRA; RLD-1
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 86%; Goat: 85%; Bovine: 85%; Dog: 79%; Horse: 79%; Pig: 77%
Reference Data
Protein Families	Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
Protein Pathways	PPAR signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.