TP53BP2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TP53BP2 antibody: synthetic peptide directed towards the N terminal of human TP53BP2. Synthetic peptide located within the following region: TLAELQEMASRQQQQIEAQQQLLATKEQRLKFLKQQDQRQQQQVAEQEKL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	124 kDa
Gene Name	tumor protein p53 binding protein 2
Database Link	NP_001026855 Entrez Gene 7159 Human UniProt ID Q13625
Background	TP53BP2 is a member of the ASPP (apoptosis-stimulating protein of p53) family of p53 interacting proteins. TP53BP2 contains four ankyrin repeats and an SH3 domain involved in protein-protein interactions. TP53BP2 is localized to the perinuclear region of the cytoplasm, and regulates apoptosis and cell growth through interactions with other regulatory molecules including members of the p53 family.
Synonyms	53BP2; ASPP2; BBP; P53BP2; PPP1R13A
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.