TRIP13 Rabbit Polyclonal Antibody

Specifications

Product Data
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TRIP13 antibody: synthetic peptide directed towards the C terminal of human TRIP13. Synthetic peptide located within the following region: LSGRVLRKLPFLAHALYVQAPTVTIEGFLQALSLAVDKQFEERKKLAAYI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	49 kDa
Gene Name	thyroid hormone receptor interactor 13
Database Link	NP_004228 Entrez Gene 9319 Human UniProt ID Q15645
Background	The thyroid hormone (T3) receptors (TRs) are hormone-dependent transcription factors that regulate expression of a variety of specific target genes. TRIP13 specifically interacts with the ligand binding domain of the TRs. It is a member of Trips (TR-interacting proteins) family. Nearly all of the Trips also show similar ligand-dependent interaction with the retinoid X receptor (RXR), but none interact with the glucocorticoid receptor under any conditions. Trips predict specific functional roles: one is an apparent human homolog of a yeast transcriptional coactivator, one is a new member of a class of nonhistone chromosomal proteins, and one contains a conserved domain associated with ubiquitination of specific target proteins.
Synonyms	16E1BP
Note	Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Rabbit: 93%; Bovine: 91%; Rat: 86%; Mouse: 86%; Pig: 82%; Guinea pig: 82%
Reference Data
Protein Families	Druggable Genome, Stem cell - Pluripotency, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.