ZNF177 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF177 antibody: synthetic peptide directed towards the middle region of human ZNF177. Synthetic peptide located within the following region: AFRNSSCLRVHVRTHTGEKPYKCFQCEKAFSTSTNLIMHKRIHNGQKLHE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	36 kDa
Gene Name	zinc finger protein 177
Database Link	NP_003442 Entrez Gene 7730 Human UniProt ID Q13360
Background	ZNF177 contains 1 KRAB domain and 7 C2H2-type zinc fingers. ZNF177 belongs to the krueppel C2H2-type zinc-finger protein family. And it may be involved in transcriptional regulation.
Synonyms	PIGX
Note	Immunogen Sequence Homology: Human: 100%; Horse: 86%; Bovine: 86%; Mouse: 83%; Rat: 82%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.