ZNF8 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ZNF8 antibody is: synthetic peptide directed towards the N-terminal region of Human ZNF8. Synthetic peptide located within the following region: AVDFTQEEWGQLDPTQRILYRDVMLETFGHLLSIGPELPKPEVISQLEQG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	63 kDa
Gene Name	zinc finger protein 8
Database Link	NP_066575 Entrez Gene 7554 Human UniProt ID P17098
Background	ZNF8 may be involved in transcriptional regulation.
Synonyms	HF.18; Zfp128
Note	Immunogen Sequence Homology: Human: 100%; Dog: 92%; Pig: 92%; Horse: 92%; Bovine: 92%; Rat: 85%; Mouse: 85%; Rabbit: 83%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.