ZFY Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZFY antibody: synthetic peptide directed towards the N terminal of human ZFY. Synthetic peptide located within the following region: MDEDEFELQPQEPNSFFDGIGADATHMDGDQIVVEIQEAVFVSNIVDSDI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	90 kDa
Gene Name	zinc finger protein, Y-linked
Database Link	NP_003402 Entrez Gene 7544 Human UniProt ID P08048
Background	ZFY is a zinc finger-containing protein that may function as a transcription factor. ZFY was once a candidate gene for the testis-determining factor (TDF) and was erroneously referred to as TDF.This gene encodes a zinc finger-containing protein that may function as a transcription factor. This gene was once a candidate gene for the testis-determining factor (TDF) and was erroneously referred to as TDF. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Synonyms	ZNF911
Note	Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Rat: 93%; Dog: 86%; Pig: 86%; Horse: 86%; Rabbit: 86%; Guinea pig: 86%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.