ZFX Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZFX antibody: synthetic peptide directed towards the N terminal of human ZFX. Synthetic peptide located within the following region: MDEDGLELQQEPNSFFDATGADGTHMDGDQIVVEVQETVFVSDVVDSDIT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	90 kDa
Gene Name	zinc finger protein, X-linked
Database Link	NP_003401 Entrez Gene 7543 Human UniProt ID P17010
Background	ZFX is a probable transcriptional activator.
Synonyms	ZNF926
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Rat: 87%; Mouse: 87%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.