Nuclear Factor Erythroid 2 Related Factor 1 (NFE2L1) Rabbit Polyclonal Antibody
CAT#: TA343368
Rabbit Polyclonal Anti-NFE2L1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-NFE2L1 antibody: synthetic peptide directed towards the middle region of human NFE2L1. Synthetic peptide located within the following region: FGRLRDENGRPYSPSQYALQYAGDGSVLLIPRTMADQQARRQERKPKDRR |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 85 kDa |
Gene Name | nuclear factor, erythroid 2 like 1 |
Database Link | |
Background | NFE2L1 activates erythroid-specific, globin gene expression.This gene encodes a protein that is involved in globin gene expression in erythrocytes. Confusion has occurred in bibliographic databases due to the shared symbol of NRF1 for this gene, NFE2L1, and for 'nuclear respiratory factor 1' which has an official symbol of NRF1. Sequence Note: The RefSeq transcript and protein were derived from transcript and genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-256 DB097304.1 1-256 257-603 DA230932.1 224-570 604-1464 AK090459.1 569-1429 1465-3372 U08853.1 199-2106 3373-4349 AC004477.2 104176-105152 4350-4891 BM983473.1 1-542 c |
Synonyms | LCR-F1; NRF1; TCF11 |
Note | Immunogen Sequence Homology: Dog: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 86%; Rat: 86%; Guinea pig: 86% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |
其它Nuclear Factor Erythroid 2 Related Factor 1产品