GCKR Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Gckr antibody is: synthetic peptide directed towards the middle region of Mouse Gckr. Synthetic peptide located within the following region: FLPVLVGFNPVSMARNDPIEDWRSTFRQVAERMQKMQEKQEAFVLNPAIG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	65 kDa
Gene Name	glucokinase (hexokinase 4) regulator
Database Link	NP_001477 Entrez Gene 231103 Mouse UniProt ID Q14397
Background	Gckr inhibits glucokinase by forming an inactive complex with this enzyme.
Synonyms	FGQTL5; GKRP
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Pig: 92%; Guinea pig: 92%; Dog: 85%; Rabbit: 85%; Yeast: 82%; Bovine: 82%; Horse
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.