SHF Rabbit Polyclonal Antibody

Specifications

Product Data
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SHF antibody is: synthetic peptide directed towards the middle region of Human SHF. Synthetic peptide located within the following region: QPLPLYDTPYEPEEDGATPEGEGAPWPRESRLPEDDERPPEEYDQPWEWK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	42 kDa
Gene Name	Src homology 2 domain containing F
Database Link	NP_612365 Entrez Gene 90525 Human
Background	The function of this protein remains unknown.
Synonyms	MGC126650; MGC126652
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Dog: 86%; Mouse: 79%; Rabbit: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.