NLN Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NLN antibody is: synthetic peptide directed towards the N-terminal region of NLN. Synthetic peptide located within the following region: CLQALADVEVKYIVERTMLDFPQHVSSDKEVRAASTEADKRLSRFDIEMS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	77 kDa
Gene Name	neurolysin
Database Link	NP_065777 Entrez Gene 57486 Human UniProt ID Q9BYT8
Background	This gene encodes a member of the metallopeptidase M3 protein family that cleaves neurotensin at the Pro10-Tyr11 bond, leading to the formation of neurotensin(1-10) and neurotensin(11-13). The encoded protein is likely involved in the termination of the neurotensinergic signal in the central nervous system and in the gastrointestinal tract.
Synonyms	AGTBP; EP24.16; MEP; MOP
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Mouse: 93%; Rabbit: 93%; Zebrafish: 92%
Reference Data
Protein Families	Druggable Genome, Protease
Protein Pathways	Renin-angiotensin system

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.