ARL9 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Arl9 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Arl9. Synthetic peptide located within the following region: EMYLPKGWLLIFVVDSADHKRLPEAKKYLHQLINPNPGLPLVVFANKQVF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	15 kDa
Gene Name	ADP ribosylation factor like GTPase 9
Database Link	NP_996802 Entrez Gene 384185 Mouse UniProt ID Q6T311
Background	The function of this protein remaining unknown.
Synonyms	ADP-ribosylation factor-like 9
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Horse: 92%; Yeast: 79%; Zebrafish
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.