TIPRL Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TIPRL antibody is: synthetic peptide directed towards the C-terminal region of Human TIPRL. Synthetic peptide located within the following region: SLMHVPPSLFTEPNEISQYLPIKEAVCEKLIFPERIDPNPADSQKSTQVE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	29 kDa
Gene Name	TOR signaling pathway regulator
Database Link	NP_690866 Entrez Gene 261726 Human UniProt ID O75663
Background	TIPRL is an inhibitory regulator of protein phosphatase-2A (PP2A), PP4, and PP6.
Synonyms	TIP; TIP41
Note	Immunogen Sequence Homology: Human: 100%; Dog: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.