ARMER (ARL6IP1) Rabbit Polyclonal Antibody

Specifications

Product Data
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Arl6ip1 antibody is: synthetic peptide directed towards the middle region of Rat Arl6ip1. Synthetic peptide located within the following region: GVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	22 kDa
Gene Name	ADP ribosylation factor like GTPase 6 interacting protein 1
Database Link	NP_055976 Entrez Gene 293551 Rat UniProt ID Q15041
Background	Mouse homolog interacts with ADP-ribosylation-like factor-6 (ARL6); Arl6ip1 may play a role in hematopoetic maturation.
Synonyms	AIP1; ARL6IP; ARMER; SPG61
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Goat: 93%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.