DHH Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Dhh antibody is: synthetic peptide directed towards the N-terminal region of Mouse Dhh. Synthetic peptide located within the following region: FRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	43 kDa
Gene Name	desert hedgehog
Database Link	NP_066382 Entrez Gene 13363 Mouse UniProt ID O43323
Background	Dhh is an intercellular signal essential for a variety of patterning events during development. It may function as a spermatocyte survival factor in the testes and it is essential for testes development.
Synonyms	GDXYM; HHG-3; SRXY7
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Goat: 93%; Sheep: 93%; Rabbit: 93%; Zebrafish: 93%
Reference Data
Protein Families	Druggable Genome, ES Cell Differentiation/IPS, Protease
Protein Pathways	Hedgehog signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.